PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 69aa    MW: 7775.09 Da    PI: 11.0481
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036543genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61e-301059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rien + rqvtfskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  Lus10036543 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALLVFSPRGKLYEFAS 59
                 8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.497161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-29361IPR002100Transcription factor, MADS-box
CDDcd002652.66E-37360No hitNo description
PRINTSPR004042.1E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.3E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALLVFSP RGKLYEFASS  60
RESKDLIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D5e-19367266Myocyte-specific enhancer factor 2A
3mu6_C5e-19367266Myocyte-specific enhancer factor 2A
3mu6_B5e-19367266Myocyte-specific enhancer factor 2A
3mu6_A5e-19367266Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134936.11e-36hypothetical protein PHAVU_010G088100g
RefseqXP_007134937.11e-36hypothetical protein PHAVU_010G088100g
SwissprotO646455e-36SOC1_ARATH; MADS-box protein SOC1
TrEMBLA0A0U2VU983e-36A0A0U2VU98_CAMSI; SOC2
TrEMBLV7ARU41e-36V7ARU4_PHAVU; Uncharacterized protein
STRINGVIT_15s0048g01240.t011e-35(Vitis vinifera)
STRINGPOPTR_0002s15310.12e-35(Populus trichocarpa)
STRINGPOPTR_0014s07020.15e-35(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-37AGAMOUS-like 20